Immunogen:
Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2)
Mouse: 94% identity (180/191 amino acids identical)
Human: 84% identity (161/191 amino acids identical)
<50% identity with Kv2.1 and other Kv2 channels
100% identity with Kv2.2 short isoform for first 47 amino acids
(ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)